PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr2P10690_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family TCP
Protein Properties Length: 211aa    MW: 22514.8 Da    PI: 6.3394
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr2P10690_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP782.7e-241502473
                    TCP 24 lsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssasec 73
                           +++ caar+F+L++eLG+++d++tieWLl+qa+p+i+++tg+++++as++
  GSMUA_Achr2P10690_001  1 MPIICAARVFQLTRELGHKSDGQTIEWLLRQAEPSIIAATGSGTIPASFS 50
                           9********************************************99877 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036343.2E-19155IPR005333Transcription factor, TCP
PROSITE profilePS5136920.861139IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 211 aa     Download sequence    Send to blast
MPIICAARVF QLTRELGHKS DGQTIEWLLR QAEPSIIAAT GSGTIPASFS TTSPSYDRFI  60
AAGGGATIGI GPATGFWALP ARADFGQVWS FAAPEMVASQ HAAFTGTFAG QPMGEASAAR  120
VGNYLPLAGH LNLLASLSGP PDVRVQINSS CSSCILSSYL LYSLDRYICN LLSMRNLILL  180
YAFFGEFLVE HYAAELVVEQ LAESKPKSIL H
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2407983e-51AK240798.1 Oryza sativa Japonica Group cDNA, clone: J065002G04, full insert sequence.
GenBankAP0047763e-51AP004776.3 Oryza sativa Japonica Group genomic DNA, chromosome 2, PAC clone:P0452F04.
GenBankAP0149583e-51AP014958.1 Oryza sativa Japonica Group DNA, chromosome 2, cultivar: Nipponbare, complete sequence.
GenBankCP0126103e-51CP012610.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 2 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009389224.12e-81PREDICTED: transcription factor TCP7-like
SwissprotQ9FMX22e-46TCP7_ARATH; Transcription factor TCP7
TrEMBLM0S6W01e-154M0S6W0_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr2P10690_0011e-154(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP194133100
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G23280.12e-44TCP family protein